SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474983472|ref|YP_007693939.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474983472|ref|YP_007693939.1|
Domain Number 1 Region: 26-187
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000000000000052
Family Protein kinases, catalytic subunit 0.0012
Further Details:      
 
Domain Number 2 Region: 363-489
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000221
Family Galactose-binding domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|474983472|ref|YP_007693939.1|
Sequence length 511
Comment hypothetical protein SHJGH_4941 [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MHSGHKLARRYRLEECVTRLDGFSSWRAVDEKLRRAVGVHVLPADHARARSVLAAARSSA
LLGDPRFVQVLDAVEENDLVYVVHEWLPDATELSTLLAVGPLEPHDAYQMVSQVASAMAA
AHREGLAHLRLNPNAVLRASTGQWRIRGLAVNAALRGITSDTPQRTDTEAIGALLYAALT
QRWPYESDAYGLSGLPKDIGLIPPDQVRAGVHRGLSELAMRALVNDGATASRHEAPCTTP
EELVKAIGEMPRIRPPEPAFTAPPEYQRTTYQQGTYGRPAPHPGATQPIAPPPPPLQSRT
GKALKWAVSALLIAALGLGSWQLADALMDRSGKSDDTNKSQTTDGGDKNAVKPKPTPIKI
QNGQEFVAKGDAQSPGNVPKTYDDDASTYWKTKSFNEGPTIAPYKPGVGIVYDLGSAKEL
GAATIDLRYGGDHTTVELYTADSLSPASLDSMTKIGSATTTGTTATVKVGKPVKTQYVLV
WLTAVPNSGYDSTLYASAGYKQAIGEVKFTG
Download sequence
Identical sequences gi|474983472|ref|YP_007693939.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]