SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474983513|ref|YP_007693979.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474983513|ref|YP_007693979.1|
Domain Number 1 Region: 7-274
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.53e-80
Family Protein kinases, catalytic subunit 0.0000000317
Further Details:      
 
Weak hits

Sequence:  gi|474983513|ref|YP_007693979.1|
Domain Number - Region: 445-504
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000144
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0088
Further Details:      
 
Domain Number - Region: 510-574
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000196
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.01
Further Details:      
 
Domain Number - Region: 378-438
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000615
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.012
Further Details:      
 
Domain Number - Region: 583-633
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00353
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|474983513|ref|YP_007693979.1|
Sequence length 664
Comment serine/threonine protein kinase [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MEEPRRLGGRYELGQVLGRGGMAEVYLAHDTRLGRTVAVKTLRADLARDPSFQARFRREA
QSAASLNHPAIVAVYDTGEDYIDGVSIPYIVMEYVDGSTLRELLHSGRKLLPERAMEMTI
GILQGLEYAHRSGIVHRDIKPANVMLTRNGQVKVMDFGIARAMGDAGMTMTQTAAVIGTA
QYLSPEQAKGEQVDARSDLYSTGCLLYELLTVRPPFVGDSPVAVAYQHVREEPQPPSVFD
PEITPEMDAIVLKALVKDPDYRYQSADEMRADIEACLDGQPVAATAAMGAVGYGGYPDDQ
ATTALRSEPGAAATTMLPPMSPDDGGYGYDERPDRRRQQKKSNSSTILLVVAGLLVLVGA
ILIGMYAFGGDGGGDGKVPVPSFVGQPEKTARKEAANVDLKVAVTKKPCEDQATGNVCSQ
DPQPDAKVEKNSTVNLVISTGAPKVQVPDVRGIQFDQAEAQLKEKGFEVEKKTQVSTQTP
DVVISQDPEGGSSKEKGTTITLTVAKPEEKVTVPDVTGKSCDEAKAELQAKGLAPNSSCT
ETPVTDPAQDGKVQNTNPSAGQQVSKNTPIAINVGKAQQPQQKPVPNVAGQPLKQAQQIL
QQQGFTQIQVNGPNDDKARVIQQTPPQGTQADPAGTQIVLTTADFGGGNNGGGDNGGGFF
GGIG
Download sequence
Identical sequences H2K5F1
gi|386841301|ref|YP_006246359.1| WP_014673800.1.21199 WP_014673800.1.57224 gi|474983513|ref|YP_007693979.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]