SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474983547|ref|YP_007694013.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474983547|ref|YP_007694013.1|
Domain Number 1 Region: 16-351
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.4e-73
Family Protein kinases, catalytic subunit 0.000000519
Further Details:      
 
Weak hits

Sequence:  gi|474983547|ref|YP_007694013.1|
Domain Number - Region: 326-399
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0235
Family beta-sandwich domain of Sec23/24 0.048
Further Details:      
 
Domain Number - Region: 477-532
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0305
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|474983547|ref|YP_007694013.1|
Sequence length 546
Comment serine/threonine protein kinase [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MSQDGAHGRYAGQALAGGRYQLRDLLGEGGMASVHLAYDAVLDRQVAIKTLHTELGREQA
FRERFRREAQAVAKLTHTNIVSVFDTGEDELNGMATPYIVMEYVEGRPLGSVLEEDIRQY
GAMPADKALKVTADVLAALEISHEKGLVHRDIKPGNVMVTRRGVVKVMDFGIARAMQSGV
TSMTQTGMVVGTPQYLSPEQALGRGVDARSDLYSVGIMLFQLVTGRLPFDADSPLAIAYA
HVQEEPVAPSSVNRALPPAVDALVARALRKNPNERFPTAESMRDECLRIAASFQAAPPSI
VPGAGPAQSGSGVGSAVFPPVDRTAPAAPHGQVQTPYPPAPAPVPNPYGHPTPAPGYGYP
QQGGYQTAPVGYGPQGAAPTPPPYTMAPQQAGRPGGGRNRRPVIVGSVAVAAVVAVGLIV
ALTLRNTGEDARGGSGGSSASASASHQAGYRGPDTTRRIDKTKCTDPQESYSDPDKIELP
DFRYKDIGSVKECLQAAGWKWDIKKEDDNTWGEGTVLNQFPEQGTDVDQDDVGTIELRVS
TGNPPQ
Download sequence
Identical sequences H2K5I5
gi|474983547|ref|YP_007694013.1| gi|386841335|ref|YP_006246393.1| WP_014673834.1.21199 WP_014673834.1.57224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]