SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474983548|ref|YP_007694014.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474983548|ref|YP_007694014.1|
Domain Number 1 Region: 11-278
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.56e-73
Family Protein kinases, catalytic subunit 0.000000483
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|474983548|ref|YP_007694014.1|
Sequence length 520
Comment serine/threonine protein kinase [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MWGNGGLVGDGRYRLTHRLGRGGMAEVFAAEDVRLGRTVAVKLLRADLAEDPVSKARFTR
EAQSVAGLNHHAIVAVYDSGEDTVGGQSVPYIVMELVEGRTIRDLLLNAEAPGPEQALII
VSGVLEALAYSHQHGIVHRDIKPANVIITHSGAVKVMDFGIARALHGASTTMTQTGMVMG
TPQYLSPEQALGKAVDHRSDLYATGCLLYELLALRPPFTGETPLSVVYQHVQDMPVPPSQ
VSEGTCPPELDGLVMRSLAKDPDDRFQTAEEMRGLVQYGLQMLYDQGGHTGTWNTGPVQT
HDGRQTPAGGFAGTTVMPHPADASGTTQIPQPILPAGYGSGDDGGFEGHGNKGSGRGKLW
LLAVFAVIAIAAGVALALKGAGGSGGNDTDIQPTKTQSKSTKHESPTPTPTDDKTDQQPS
DPETSNGSDTGTGSGWPPATTPSYTPSRTASSTPSTEPSQPQTSQSQPTDPTNGGTDTGG
TDTGGTDTGGTDTGGTDTGGTDTGGTEGTTTDGSTGLTTG
Download sequence
Identical sequences A0A101QBM8 H2K5I6
gi|474983548|ref|YP_007694014.1| gi|386841336|ref|YP_006246394.1| WP_014673835.1.21199 WP_014673835.1.28171 WP_014673835.1.57224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]