SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474983588|ref|YP_007694054.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474983588|ref|YP_007694054.1|
Domain Number 1 Region: 160-318
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000106
Family Tetratricopeptide repeat (TPR) 0.061
Further Details:      
 
Domain Number 2 Region: 7-69
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0000000000217
Family EDF1-like 0.084
Further Details:      
 
Domain Number 3 Region: 273-424
Classification Level Classification E-value
Superfamily TPR-like 0.000000000104
Family Tetratricopeptide repeat (TPR) 0.022
Further Details:      
 
Domain Number 4 Region: 86-187
Classification Level Classification E-value
Superfamily TPR-like 0.00000593
Family Tetratricopeptide repeat (TPR) 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|474983588|ref|YP_007694054.1|
Sequence length 447
Comment regulatory protein [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MRERDDPEVIGRRVQRLRNQRGLTQRQLAEPAYTPAYISTLEAGRVRASDEALRHIADRL
GVAFEELAVGRPAHLATDLRLRLTEAQRVLADGRAEEAAAQYAVLRAEAEAHALGCEYAA
ALLGLGECALETGQLTAAREYFEQAEERLADKTLPVRVPALRGRAVAHYLAGELRYAVYL
LETALDELNRGGLHDPDALLLLYASIIGPYMDMGAHARAAQAAELALALAPQAGDPALVA
RMHRSVARTLLAEGRAAEADASLAKAAELYRRLSLRTELANCHWMRGYVCAQNGELERAE
DELRQAYAMLSQTRAALYRSQAAVELADVLHRRGKSGEAAELLEGVLGDFSSERGAVHAA
GAHRLLGIIAEDARDTEAAEEHYVRALSLLERAGAAGDLADLCRLLGDLFRRTGRVEAAL
DAYRTGLGHRTAPGTTTLGPAPAQPPL
Download sequence
Identical sequences H2K785
WP_014673875.1.21199 WP_014673875.1.57224 gi|474983588|ref|YP_007694054.1| gi|386841376|ref|YP_006246434.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]