SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474983702|ref|YP_007694168.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474983702|ref|YP_007694168.1|
Domain Number 1 Region: 59-304
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000000181
Family Atu3015-like 0.078
Further Details:      
 
Weak hits

Sequence:  gi|474983702|ref|YP_007694168.1|
Domain Number - Region: 458-574
Classification Level Classification E-value
Superfamily TPR-like 0.0319
Family Tetratricopeptide repeat (TPR) 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|474983702|ref|YP_007694168.1|
Sequence length 758
Comment hypothetical protein SHJGH_5171 [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MSALFDRRPTADASGSSAVAAGGSIGQAVTGPGAVGLHIENVAALLPDACPPAESVRAPA
RLTNLPFRADLCLGRDAQLALLHDARGTSGRPLVHVVHGLGGIGKSTLVARMAAEHTGAG
PVWWIKADSRAAIDAGLAHLASVLQPSLGTVLPREQMSEWALRWLTAHTGWLVVLDDVAH
PADAVPLLARVTSGRFLITSRLTAGWQGIAEEVPLGVLSPQDAVRLFTEIHGADPDAARL
CAELGHLPLAVTQAAAYCRMTHCTASTYLEELAKSPADMYAETVEGGDHERTVARVWHVT
LDRLADDPLAVRILLMLAWYASEGIPRDLFASLDRSLAVRRAFGRLAAHSMITLSGDTVS
VHRLVQAVSRAHSPGDRHRGQEAVEAARGAAVDALAVALPEDMDEPSAWPVMRSLLPHAE
ALAEHVRCEDDTPAMVRLLARTGDYLLDSGGKAAARGMELLRRAEAGCLRLHGAEAEETL
EVRVALARVTRMLRPLAESAPPAETVVADCTRILGADHLVTLDALSNLRRIVWLKGDADR
AVRLAEECLAGLVRLRGPDHPDTLRARHDLVMTLDDTAGEAGTRDMRAELLRDCRRALGE
EHPVTLSVRNLDTVLARRPVFHPDVNQTVAGLFSVAEEGGREDLLGLVRVLMDQVMALGP
LDDFLPRTTEEDVRKAERDLETSRRVLGDASTGVLEAQLALLLVYGTSRDERYEEAATAL
LQELFAQLSENPSVMTPLLRVLEAFGSVLGETARPEGS
Download sequence
Identical sequences H2K962
gi|474983702|ref|YP_007694168.1| WP_014673989.1.21199 WP_014673989.1.57224 gi|386841491|ref|YP_006246549.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]