SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474983718|ref|YP_007694184.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474983718|ref|YP_007694184.1|
Domain Number 1 Region: 244-501
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.48e-20
Family Extended AAA-ATPase domain 0.059
Further Details:      
 
Domain Number 2 Region: 107-256
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000155
Family BTAD-like 0.017
Further Details:      
 
Weak hits

Sequence:  gi|474983718|ref|YP_007694184.1|
Domain Number - Region: 752-858
Classification Level Classification E-value
Superfamily TPR-like 0.000261
Family Tetratricopeptide repeat (TPR) 0.06
Further Details:      
 
Domain Number - Region: 20-85
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.000646
Family PhoB-like 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|474983718|ref|YP_007694184.1|
Sequence length 1081
Comment LuxR-family transcriptional regulator [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MTTELALLSEVACRGREITAPRLRGLVALLAGDLRAGCSTGRLVEGLWPDGLPERPGKAV
QVLVSRLRAQVGGELVVSTPTGYRLALEEAQVDSSALLLFEAGSAERARAGDHAGALAQA
EAGLALWDGSVGAGAGEDLHDPVVALRTDRLRAHRSLVRSRALALARLGRREEAAVPLAE
LARELPRDEEVLAELLRCEADTVGRAAALTRYDAYRRRLREELGTDPGPGLRSLYQELLS
ADAPRVRQGVPHEPNPLLGRDADVSAVAGLLRAARVVTVVGPGGLGKTRLSHAVSRAAEQ
PVVHFVPLAGVTADDDVAAEVASAVGAGEGRQFAGGGDAVSGIAGALGTGPTLLVLDNCE
QVIAGVADLVRALVSRSKELRVLATSRAPLGLTSESVYALPELSLATSVELFEQRARAAR
PGVDLPADRVAEICRHLDGLPLAVELAAARVRVLSVADIARRLRDRFALLRGGARDAPER
HRTLHAVVEWSWNLLEPDGQAALRALSVFPGGFAEDAAEYLLGGAGDALFLLEQLAGQSL
VKVDDSPSGTRFRMLETLREFGAARRAEAGEEEVVTDRFLDWARDFGREHHDVLFSSDPA
PSWNRIRAEQDNLVLALRHALARSDGPTTAALTAVLASLWATDSHFTRLAALIADTGGPL
SHFRPGPEDVEPARTAAAVCTASLFMAHGPHAVRPLATLRRLPPAPPDTLLRALAVVLCA
VPDIHPPAYALLRELCDAEEPLLAGVAACFASYVWDAAHETERALEYARRMLDALEPLAN
PAMQLLCHGRISELCLQSERGAEAYDHLRAALAALDRFGDWSDSIGVRWGLVLACLQRGE
VDEAEYWLGLAALEQPPDSPQIYTPDLLARAEIALARGLTEVGLGLWRRAVERVREDSLL
YAGDPFVHPWSLQVQSAALAAHAQHGRLEPVAGLAGQLRERLLGMLSGASGTTGSSGTTA
SSTSDSSGSPSTWNSPDPPGSPGTSGSPDSPGSPVELHVYGTVLLALGLAGLARGDTAAV
RLVALAERMPVVRDFPTLSSARSRQAAENADRAAYADARSRYAALGREELRAAALRELSA
G
Download sequence
Identical sequences H2K978
WP_014674005.1.21199 WP_014674005.1.57224 gi|386841507|ref|YP_006246565.1| gi|474983718|ref|YP_007694184.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]