SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474984219|ref|YP_007694686.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474984219|ref|YP_007694686.1|
Domain Number 1 Region: 70-224
Classification Level Classification E-value
Superfamily TPR-like 1.33e-31
Family BTAD-like 0.00069
Further Details:      
 
Domain Number 2 Region: 1-68
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.000000000312
Family PhoB-like 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|474984219|ref|YP_007694686.1|
Sequence length 226
Comment pathway specific regulatory protein [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MLTMLALNPGQVVGFDELIDELWGEAPLKNTRNALQANVRRMRKSLAELGFPDGEEGLIR
TVDNGYMLDVPQEALDAYRFLRLAEQGATLVAREPHESVRLLRESLAMWRGPALLDVSDG
PRCRAVALRLDEQRKTAREDLIQAQLQAGEAGVVVAELKQLLAQYPERERFSEQLMIALY
RCGRQSEAVDIFHRTRKWLDDELGLKPSKRLHTLYQAILMQDPSLL
Download sequence
Identical sequences A0A101QIM7 H2JUK2
gi|386842009|ref|YP_006247067.1| gi|474984219|ref|YP_007694686.1| WP_014674488.1.21199 WP_014674488.1.28171 WP_014674488.1.57224 WP_014674488.1.88765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]