SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474984541|ref|YP_007695007.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474984541|ref|YP_007695007.1|
Domain Number 1 Region: 246-476
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.43e-56
Family Prokaryotic proteases 0.0000038
Further Details:      
 
Domain Number 2 Region: 452-558
Classification Level Classification E-value
Superfamily PDZ domain-like 3.15e-16
Family HtrA-like serine proteases 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|474984541|ref|YP_007695007.1|
Sequence length 566
Comment protease [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MRGEAGGDSRGDAGGGIQGGAGGAVRERAGGDAVAAEEASWAAPVERPKPLHDPDPYSTP
PYGEPGPWAPAPPVQHPAATPAHGTAVSAPTTPPPAAPTASLPAPTAPLSAPTAPLPAAM
AHAPAPHVPGPAPAPHVPASAPAPAAHVPAPTAPAPEGSDPWGRYDPWAGGSAKEQAPVR
EPLQQTGAGVPTEQQRKRSARRILFAWTLVVALFSAGVGGAAGAYLQREGFGDDVRLPQA
GSVPAGRAPDSVAGIAARALPSVVTLHVRGADEAGTGTGFVLDAEGHILTNNHVVEPAGT
GGEISVTFSSGDTVKAEVVGRDSGYDLAVVQVRGVHGLTPLPLGNSEDVEVGDPVVAIGA
PFDLANTVTSGIISAKERPITAGGEKSDGSDVSYVDALQTDAPINPGNSGGPLLDSRAQV
IGINSAIRSAGSGSEADGGQAGSIGLGFAIPVNQAKRVAEELINDGHATHPVIGVTLDMG
YTGDGARIDSKSASGGSAVTRGGPGERAGLKAGDVITEAGGERVHTGQELIVKIRAHRPG
DRLRLTVERDGIEREVSLVLGASEQN
Download sequence
Identical sequences H2K0I8
WP_014674810.1.21199 WP_014674810.1.57224 gi|386842331|ref|YP_006247389.1| gi|474984541|ref|YP_007695007.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]