SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474984625|ref|YP_007695091.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474984625|ref|YP_007695091.1|
Domain Number 1 Region: 19-110
Classification Level Classification E-value
Superfamily TPR-like 0.000000000285
Family Tetratricopeptide repeat (TPR) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|474984625|ref|YP_007695091.1|
Sequence length 326
Comment hypothetical protein SHJGH_6094 [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MRIFGKGRHRPSASWRQATDRAFTLIGDGRYEDAGELLTRAADLEPWLSESWFNLALLHK
FRHDWEQARAAGLRAVALLDRETGAPDWWNVGIAATALQDWPLARRAWQAYGLKVPGGAA
ASAEPVGMELGSAAVRLSPEGEAEVVWGRRLDPARIEVLSIPLPSSGRRWGEVVLHDGVP
HGERTTSAGHSYPVFDEIELWAPSPVPTWVVLLEAATEADRDALEQLAADAGFAAEDWSS
SVRLLCRMCSESRMPSDEGEGVHLDPHDHSEPGHPGPLGHRTDGQLWVPERECGIAAPAS
LVRGLLDGWVADSPDSRDWRDLEEVC
Download sequence
Identical sequences A0A117Q9G0 H2K251
gi|386842415|ref|YP_006247473.1| WP_014674894.1.21199 WP_014674894.1.28171 WP_014674894.1.57224 gi|474984625|ref|YP_007695091.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]