SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474984675|ref|YP_007695141.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474984675|ref|YP_007695141.1|
Domain Number 1 Region: 37-154
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.0000000989
Family Prokaryotic proteases 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|474984675|ref|YP_007695141.1|
Sequence length 799
Comment hypothetical protein SHJGH_6144 [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MTWQERTADGAWEPRGGTGTAVVVAPRPEAGRPARDPWPFPDLALVRVTGADEVRCLWLG
DREAGPRTPLGLYGWSVQTGELGIRQGSGELAGSDARALLLTGILPVGGLSGGPALDLRH
GSVIGVIKGRRREEGVAVPVTALYELLDSREVGRAVREVLRAHDLHHASLLGASSPYPHW
TAVQATLPGHTSSVSGISTELRTRLYGHLAHLPPPAGAGEVVHLVEDVKEQVRGERLPSL
VLRNVRTWREGAALLYGLRTLDPGGGGTLVDLDAVLLYAARVARKAAREHAGEVEAGRLR
AFTEWIAGQAAGHRHWAVGEAIRALLEGAEAAGPADGPTPAVPGGLSGGRPDGPYGSGLG
GPPGSQPDGMSGGRSGSPSNGVPVPNGAVVAPAQAIPAQGGAVDVPTPVGALEAPSVPEA
LSVLEAPSALEAPSTVECLGTPSSTGPGAAPLPAGSAHPPAGGRAIQPHATAPSLPTPSP
GTRTDVLVKVGPATYGRHPWSVQLIYGGQDVTPVDGDDRGVRAEELARVLREPLATALNQ
GDHGEHLAAIEVFLPRKLFDLPVDDWQLLPDPSPTTAATATTAFDDENHEGDEGDEDDEY
DEDDDFVDERALPLGMRRTVVVRDVRRNGLPPSPEWRRRWKGVLRGPLAHGTLNGRPAAE
GHPPGARAGGRFPYYGALSAMSDASVPVYCGPVGSGEGYAAMRDALRSGHAVVLWRRDQH
DHDECGDFHRQAADLLGLAGHADGLHGPVRDLRIRLADPDTARAHGLRGKIAVLFDPPPD
RTPYGTESMRPPPLAAPGG
Download sequence
Identical sequences H2K3V4
gi|386842465|ref|YP_006247523.1| gi|474984675|ref|YP_007695141.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]