SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474984680|ref|YP_007695146.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474984680|ref|YP_007695146.1|
Domain Number 1 Region: 170-370
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.27e-24
Family Nitrogenase iron protein-like 0.023
Further Details:      
 
Domain Number 2 Region: 603-718
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000067
Family Tetratricopeptide repeat (TPR) 0.03
Further Details:      
 
Domain Number 3 Region: 810-960
Classification Level Classification E-value
Superfamily TPR-like 0.000000000171
Family Tetratricopeptide repeat (TPR) 0.015
Further Details:      
 
Weak hits

Sequence:  gi|474984680|ref|YP_007695146.1|
Domain Number - Region: 18-79
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 0.0118
Family Toll/Interleukin receptor TIR domain 0.021
Further Details:      
 
Domain Number - Region: 739-786
Classification Level Classification E-value
Superfamily TPR-like 0.0872
Family Tetratricopeptide repeat (TPR) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|474984680|ref|YP_007695146.1|
Sequence length 1000
Comment ATP/GTP binding protein [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MAEQRRPGANGAAAPEHVLVVFPGYYRSWAAWIAQCLERHGHRATLQRWDPPREVDLEDS
LGDLLLASGKVLLVLNDWFFELGPRPPGEWNDALRGFVAAHADRFAAVNLTNRPLLPATA
VLEPASLWALSEEAAEDRLLRRLGLEPLTRPRTLAGRIRYPDERCEIWGEVPRRNPRFTG
RDDLLGELHQRLADAERGAAACTLVGMSGIGKTQLAAEYAHRFSTDYDLVWWVNSDDRTL
QRDRLGELAVELGLRIGGEPGERIRAVRNALRRGEPYGNWLLVFDGWDDIDGVTSLLPQG
TGHVLITSRNRGWNEHTDVLEIPAFLRPESTAYLMRRAPHITAREADEVAAEFGDVPLPL
VQAASWLGESGMEAAEYLRMVRERRLSTVDEPVTGEGFPQSSLTSWAILLNRLRRSQPQA
IEVLGLCTSFAPGRIPLGLIRAYPRAELPEELRWMSTDLPAWTRALDTLVNYSVLTRETR
GPLAAEMGPHQESVHMHRLVHDIVSKLTGDGSHELHRRAVRTLLAEADPGNPADSRNWPR
YAELLPHLEPSGALESRQPRVQELVLNCLRYCTRSGEYSGGLELAQQVREHWSRFMDPID
QPMLDLATQEGNMLRNSGRFREVYELHRGVLRQLQAAPRRNEIGELVSKSAIASGLRSLG
RYQEAYDLQREVLDGNERLLGPDEPPTLVARHNLGVTLRMLGRYAEALDLDLETLARRES
VLRARHINTLHSGNAVTHSLRLLGRYREALARQEPVVRLHVQVLGPQHPQTLEARSQLAM
CRRREGGHGPDVGPGMASLLDQLTQLHGREHYRTLAFLTNYGNYLREHGDLSQARDLIDE
AEAGYRSLLGPAHPVATGMLSNTGLVMQAAGERGEALSMFESALAGLGATLGQDHPWVLG
CALNAAGARNFNGRIEDAVELSRDTVRRSRHALGQEHPLTLSCQVALAADLRAAHEQEEA
GKLEEDALLSLTRTLGAQHPHTISARGRVRPYWDFEAYLG
Download sequence
Identical sequences H2K3V9
gi|474984680|ref|YP_007695146.1| WP_014674948.1.21199 WP_014674948.1.57224 gi|386842470|ref|YP_006247528.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]