SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474984786|ref|YP_007695252.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474984786|ref|YP_007695252.1|
Domain Number 1 Region: 47-154
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.45e-30
Family Thioltransferase 0.0034
Further Details:      
 
Weak hits

Sequence:  gi|474984786|ref|YP_007695252.1|
Domain Number - Region: 187-274
Classification Level Classification E-value
Superfamily TPR-like 0.00263
Family Tetratricopeptide repeat (TPR) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|474984786|ref|YP_007695252.1|
Sequence length 323
Comment thioredoxin [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MQPRNMSMSGVVDLAAVKAAQEAKAKAEQARAEAARQGGTGAVSPADLVIDVDEAGFERD
VLQRSAEVPVVIDFWAEWCQPCKQLSPVLERLAVEYNGRFLLAKIDVDANQMLMQQFGIQ
GIPAVFAVVAGQALPLFQGVAGEQQIRETLDQLVAVAEQRFGLTGLTVDPDAEPGGAPQA
AAAEGPYDAALNAAAQALDAGDLGGAVQAYKNVLADDPAHPEAKLGLAQAELLQRVQGMD
PQKVRQEAAEKPKDARAQIAAADLDLVGGHVEDAFGRLIETVQRTAGDDREAVRLRLLEL
FEVVGQEDPRVVGARRALARALF
Download sequence
Identical sequences A0A0S2P6N1 H2K5S9
gi|386842577|ref|YP_006247635.1| gi|474984786|ref|YP_007695252.1| WP_014675055.1.21199 WP_014675055.1.57224 WP_014675055.1.88765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]