SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474984892|ref|YP_007695358.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474984892|ref|YP_007695358.1|
Domain Number 1 Region: 920-989
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 2.96e-20
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0016
Further Details:      
 
Domain Number 2 Region: 2-91,137-247
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000294
Family Extended AAA-ATPase domain 0.077
Further Details:      
 
Domain Number 3 Region: 551-721
Classification Level Classification E-value
Superfamily TPR-like 0.00000000164
Family Tetratricopeptide repeat (TPR) 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|474984892|ref|YP_007695358.1|
Sequence length 1000
Comment LuxR-family transcriptional regulator [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MFVGRADELDTLNDALARAAAAEPQALLLGGEAGVGKTRLVEEFATAAARHGAVVAVGGC
VEIGADGLPFAPFSAALRALRDALPEEFAAAAAGQEEELARLLPDLGEAGAGRHDEQGTA
RLFELTARLLERIAAEHTAVLVLEDLHWADASTRHLLAYLFRTLRAGRLLVLATYRSDDI
HRRHPLRPLLAELDRLRTVRRIELARFTREEAGRQIAGILAAEPDPAQVDEIYARSDGNA
FFIEELAVAATAGDCAGLTDSLRDLLLVRVEALPESAQKVARIVAEGGSTVEYRLIAAVA
RLAEDDLIEALRAAVGAHILTATRTGDGYRFRHSLVREAVADDLLPGERSRLNRRYAEAL
EADPTLVPADARVMRLASYWYHAHDPAKALPAVLSAAVVARRRHAYTEQLRLLERAMELW
DSAPEEIRSALRPVDYAEVYPPCGCDPATTPLRYLDLLAEAAVAGRFGGERERALKITKR
ALRLLDEEPDPLRAAWFWVQRSRLVQAMARGDGRQELATAQDLVRGLPPSEVHAEVLAVA
ASWSMQRRPGPEALAAAERAVEYAHMVGARETELDARLTLGGLTVEAGAPKAGLAEMRQV
LRDTRAEGMHQVAARAYVNLPSVLQSVGRDREAVPLLREGIEFCRAYGLLDSGAWMWGNL
SEALYSLGQWQEAAEAAAHATRVGHGAMPRGAGALTQARLALARGDLAEAGRHLAAARAW
YGTHDPMPQQSLPVARVALGVAAAEGRITDARAALLPALDAGFPPGTHRYGWPLLLAAAT
AEADARALPAALPSRTETLDRLSTAVRTLTTGVPLWQAYGQWTRAELLRAQDRDTADTWS
PVVTAFECLDRPYALARVRHRLAAALLAEGGDDERERAVELLRLAGAVAAHLGARPLADT
VARLAQRARLTLTGATRRTPADPATALGLTSRERDVLHLVAAGRTNRQIAAELFISPKTA
SVHVSNILGKLGVSGRGEAAAVAHRLGLFAAGTLAAETPG
Download sequence
Identical sequences H2K9A4
WP_014675160.1.21199 WP_014675160.1.57224 gi|386842683|ref|YP_006247741.1| gi|474984892|ref|YP_007695358.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]