SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474985185|ref|YP_007695651.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474985185|ref|YP_007695651.1|
Domain Number 1 Region: 119-334
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.0000000000000115
Family Prokaryotic proteases 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|474985185|ref|YP_007695651.1|
Sequence length 375
Comment secreted protein [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MSVLALTATACAGDDNADGKPSAVSTGDGKITIPDDLRHRLKEHGIDVDKWKNGAWKNWN
RDDWLREANDFINPIIKGLWDPDRMRGADDPDQGVDDNDISGDQGVTDPTPQPVQARAVT
PPYHTSAATSGKLLFDAPEGTMVCSATVVTDPAHPGKSNLVWTAGHCVHAGKKGGWYRNL
AFVPSYNDQGMSAAELENASRSEIAPYGVWWADAAKTSQQWISKGGETGGDGASYDFAVI
HVTPEQGSGGKSLEETVGGALPVDFDAPAVSQVQSITASGYPAAAPYDGQRLYQCQDKPG
RLSIEQSDPTMYRIGCTMTGGSSGGGWVETGADGKPALVSNTSIGPVRSGWLAGPRLGEV
AKSLYESVSKQFAGR
Download sequence
Identical sequences A0A101Q0F8 H2K0S8
gi|474985185|ref|YP_007695651.1| WP_014675449.1.21199 WP_014675449.1.28171 WP_014675449.1.57224 gi|386842977|ref|YP_006248035.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]