SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474985537|ref|YP_007696003.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474985537|ref|YP_007696003.1|
Domain Number 1 Region: 131-378
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.94e-37
Family Protein kinases, catalytic subunit 0.00036
Further Details:      
 
Domain Number 2 Region: 520-625
Classification Level Classification E-value
Superfamily TPR-like 0.00000443
Family Tetratricopeptide repeat (TPR) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|474985537|ref|YP_007696003.1|
Sequence length 755
Comment serine/threonine protein kinase [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MTSCVRPGCAGRIMGTGYCDTCGHRHAEPRSAPPARPPAGAVEEPEPPGPAAVHAVAGTG
ELDQHGLVVLPDVPVPDDVLVEDPRPPTGGRRCGANGCTMTIGIGYGGQPAPDTGRCPRC
GTPYSFRPQLTRGDIVADHYQVLGCLAHGGLGWVYLAEDTRAAGHRVVLKGQINVHDALA
RRTAVEERRSLTDLHHPDIVRIITYAEHRAPGRPPTGYLVMDYIGGRSLQQLFDADDVER
IFHGRPRLDHVLTYGCKILGALQYMHERGLLYCDMKPANVIHFGRALKVIDLGAVRAIGD
RTSAHVHTAGYAPPQEEIDRRGWHVDSDLYTVGMTLQALARNTEPARGLAPDSFRRLIAR
ATHAEPRARFRSAAEMSRQLWEVLREFRSLQFGEQLPESSTRFRATGAGLDAGLGAIPAL
DHWTTRPGERPAGLDVSPPAAAEVAGALPEPLPDPDDGAALLLDTFPPDAPDRVARQWPR
ESRLGTPETALWLCRAYLRKGEQQAAESWLAEAETQLGERAAHDWRIAWHHGVLHLSKGE
VEPAGARFDAVYRALPGEYAPKLALGYCAEHTGSRPADRGRPTRAMRYYEAVWKRDSAHT
AAAFGLARGHLAGGDRDAAVHVLDEVPATSRHHDAARIAAVRVRAGVLHGDPPTPAGLRD
AVRRLPELRLDGGATAGESRARLVAEVRENALHGRPAQGWGPDFPAGELLGPGDEDGLRT
RLEHSFRQLAAQARTAGEHGRLLDLAHAVRPMTTF
Download sequence
Identical sequences H2K9I6
WP_014675799.1.21199 WP_014675799.1.57224 gi|386843329|ref|YP_006248387.1| gi|474985537|ref|YP_007696003.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]