SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474985542|ref|YP_007696008.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474985542|ref|YP_007696008.1|
Domain Number 1 Region: 32-257
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.75e-64
Family Eukaryotic proteases 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|474985542|ref|YP_007696008.1|
Sequence length 263
Comment trypsin-like protease [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MFGLTRARKTAATVVATAAAAASALLASPTASAAPQPIVGGTTTTTTAYPFMMQITDASQ
NQFCGGTLVAPKKVVTAAHCMVGETTSSVRVVGGRTYLNGTNGTVSRVSSIWINPDYTDA
TNGDDVAVLTLSTSMPYTAAKYVSSSQTSVYAAGTTARILGWGTTSENGGSSNQLRTATV
PVVSDSSCRSSYGSDFVQSDMVCAGYTSGGVDTCQGDSGGPLLIGGVLAGITSWGEGCAE
AGYPGVYTRLTTFSDLVTAQVGS
Download sequence
Identical sequences A0A0S2P8Z9 A0A101QKJ6 H2K9J1
gi|386843334|ref|YP_006248392.1| gi|474985542|ref|YP_007696008.1| WP_014675804.1.21199 WP_014675804.1.28171 WP_014675804.1.57224 WP_014675804.1.88765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]