SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474985545|ref|YP_007696010.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474985545|ref|YP_007696010.1|
Domain Number 1 Region: 807-875
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 9.86e-18
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0044
Further Details:      
 
Domain Number 2 Region: 556-694
Classification Level Classification E-value
Superfamily TPR-like 0.0000000152
Family Tetratricopeptide repeat (TPR) 0.036
Further Details:      
 
Weak hits

Sequence:  gi|474985545|ref|YP_007696010.1|
Domain Number - Region: 670-787
Classification Level Classification E-value
Superfamily TPR-like 0.00209
Family Tetratricopeptide repeat (TPR) 0.062
Further Details:      
 
Domain Number - Region: 58-189
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0121
Family RNA helicase 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|474985545|ref|YP_007696010.1|
Sequence length 878
Comment LuxR-family transcriptional regulator [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MRTVLRCSATESESHLPFLALADLLGLVLDEVSGRLPAAQRTALESALTGRGESSLQRDG
LALRLAVLSALRALAAHGPVLVVADDLQWLDPASAELLGFAARRLEGTPVQLLCAVRTEG
RQSQEYDRHLRACPPGTLAVRLGPLSRTQVAELLDHRGHGCLSRSTVREIHRTSGGNPLF
ALELGRALADSPTPPRPGEPLPVPTSLRALVLSRLDMLSVEARRTLLVASAGARPTPALL
HAAGRENAEAECAQAAELGLLATEPDAPAVRFAHPLISAALYAEAPAHERRAAHAALSTA
ASDPIERARHLALATTGTDPGVATRLAEAAALARDRGAPSVAAQLGLLAARHTPADGAPS
PQERRLTAAEDAITAGEVDLARDIAREVLARATVPADRVRAWMIVIDTAGHTMAEVDAVF
PQALADAGDDPRLLALVHYQLAWRALIVEGDFTEAREAAAHAAELAARGEDRRTELLSLA
FQAQTETLMGHPEAPRTIKRALKEPQDPRVAWHHNGAGSARFRWLVMGDQLAEARTTVTA
LLREVRRRGSVESEVHFLRGLAETELRAGHCGRALELARDSLRLARDSGIGETASAMLTS
LAEASGGDVDRALALAREAVDHAEEDGDQMYLSRALGALGYAQLVAGDPTGTVRSLRRVR
TLELGLGITDPARGRWHGDLAEALVRTGEVAEAQDVIDVSREHALRLGRESVLAVLDRSE
ALVRAARGDLEAALAQLTSAQERLGKLGYGLEEARAAFALARLRGGPRPGSAVFDEATRM
FRRCRALPWLRQVDESPAAAGPEPAPAAPQAPAALLALAAMERQVAALVMEGATNREIAA
RLFISVKTVEATLTRVYRKLGIRSRVDIVRLAAGHRAP
Download sequence
Identical sequences H2K9J3
gi|386843336|ref|YP_006248394.1| gi|474985545|ref|YP_007696010.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]