SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474985571|ref|YP_007696037.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474985571|ref|YP_007696037.1|
Domain Number 1 Region: 48-239
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.0000000000000655
Family Prokaryotic proteases 0.094
Further Details:      
 
Domain Number 2 Region: 198-495
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 0.00000128
Family Integrin alpha N-terminal domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|474985571|ref|YP_007696037.1|
Sequence length 548
Comment FG-GAP repeat domain protein [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MAGARPLDAARHVPAEPGAATAAAGRPKGTLFTGTRLVGTFFGADGPGGTTWHCTGSVID
TKARNIVLTAAHCALNMTGDYIFVPKFVKGAAPDRQPYGIFHIQRIFIDPRYVPDRGSAT
TKKAASDLDTAFARVSANQRGTSLQDAVGGGLTFTRPAGYTHRNVTVVGYPSHRHNSAGR
AVRCTVPTTQLRGYRQLSMTCGGYYGGVSGSPWITDYQDDARTGHVIGDLGGYNGGGNDA
DADYISYAAAFGADAANLLADAVADQAPPADLPPYRGLKGSLPGGAARWRKAALMASGDY
TGDRHGDLLVVWPDGGVTLHPGDGKGGFLAEKRLRRANSTWTHARTLTGGTFTGGTRSGL
LVRWSDGEVTLYPQPGPSGLGREIRMAPPGPAWKKAVQFTSGAFRADGGTGLLVRWADGA
LTLYPRIGTGGLGTGTRLVAANGTWTKAALLAGGDFDGTAGGDLLVRWADGALDTYTGTS
AAGLGTRTRVRGPNSLWRHAQALTVGGFRHGDPGNDLVVRWSDGETTLYADTGTKAVGTE
HTLVHPGT
Download sequence
Identical sequences H2K9M0
WP_014675833.1.21199 WP_014675833.1.57224 gi|386843363|ref|YP_006248421.1| gi|474985571|ref|YP_007696037.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]