SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474985634|ref|YP_007696100.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474985634|ref|YP_007696100.1|
Domain Number 1 Region: 826-891
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 2.72e-16
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0067
Further Details:      
 
Domain Number 2 Region: 406-427,469-540,768-797
Classification Level Classification E-value
Superfamily TPR-like 0.000000167
Family Tetratricopeptide repeat (TPR) 0.03
Further Details:      
 
Domain Number 3 Region: 19-217
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000433
Family Nitrogenase iron protein-like 0.074
Further Details:      
 
Domain Number 4 Region: 499-542,575-663
Classification Level Classification E-value
Superfamily TPR-like 0.0000221
Family Tetratricopeptide repeat (TPR) 0.067
Further Details:      
 
Weak hits

Sequence:  gi|474985634|ref|YP_007696100.1|
Domain Number - Region: 702-828
Classification Level Classification E-value
Superfamily TPR-like 0.0237
Family Tetratricopeptide repeat (TPR) 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|474985634|ref|YP_007696100.1|
Sequence length 897
Comment regulatory protein LuxR [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MERLRALVGSVARTGSAALALIRGEAGIGKTVLLDDCAGHAGAAGFAVGLGKADELHHLV
PLSSLMACLTHQDRPLLSDEAFADLSRGHDHRIWLVQHLAEQIEALAARTPVLIGLDDVQ
WADPLSRSVLAQLPARVRTSPVLWLLTRRPDASGEADEIFAAASRALPAVDVRLGPLSAS
AIAQLADDVLGTDVDEQVRDLLEGAGGNPFLAVELLTGLRSTNSPGEPVPTGLVAGVRGR
LSALSPGTLRLLRIGAVLGRRFRFQDAVALSGQPSPAMVGMLDEAVRVNLLADEGDCLVF
RHDLLRQAVYADIPPAHRRALHREAAQQLVTAGHQPIEAVSHLLTGALPGDEEAVLLLRR
AADDVLPVTPALAADLLTRALELTPPQHPSGFDVGERTIVALTRAGRNKEALATGERLLA
RRPPPAVSSRLQAAIGATLWNLDRAEDLRRRLDATLAAGGASPETAARLRALRALALSRG
NDLSAARADGEAALREAVAIGDREAHVQALFGLGETALNAGETAEALRLFTTLSAVDPAY
LPEEVMACQHLDDFARGEHLLARATGQKDGSLREGMLLWSQGHQRLGLGQLDDAEADFVT
VERLENEVEAPVHQVNARVVRSRIGLLRGDLAAARHDLVAARERLAVKPNPGNTAAVRFL
EALHAGAADDHARALERLREVQRHDGLMRWRLLRTWVDEAVRIALRGGDRELAEDLAAQA
EAHAARNPDVPTATGLAAQTRGLVANDVGLLGRSVTLLRGGPRPLNRAAALVDLGTALVN
AGRRAEAVEALTEARATFAESGAHAAAARAQSLLGRAGARARRASAGPRPSQGWEALTAS
ERKVARLVAAGHTNRSAADLLVVSPHTVNTHLSAVFRKLSVNSRVQLTRVVAASEDD
Download sequence
Identical sequences H2JKS0
gi|386843426|ref|YP_006248484.1| gi|474985634|ref|YP_007696100.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]