SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474985893|ref|YP_007696359.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474985893|ref|YP_007696359.1|
Domain Number 1 Region: 610-716
Classification Level Classification E-value
Superfamily TPR-like 0.0000000015
Family Tetratricopeptide repeat (TPR) 0.023
Further Details:      
 
Domain Number 2 Region: 18-104,149-260
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000133
Family RecA protein-like (ATPase-domain) 0.062
Further Details:      
 
Weak hits

Sequence:  gi|474985893|ref|YP_007696359.1|
Domain Number - Region: 404-509
Classification Level Classification E-value
Superfamily TPR-like 0.000584
Family Tetratricopeptide repeat (TPR) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|474985893|ref|YP_007696359.1|
Sequence length 892
Comment regulatory protein [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MTQGRPSAAGSAPLWERDAELATVAQALDVLCADQSSAGSLLVIRGEAGLGKTALLAEIR
RIAERRGCAVWSARGAETLRSVPFHVVRQLLQPALLSLLPEEAREYLGDWYDIAGPALGI
AEPRAGKADPQYVCDGLVAAVRRLSSRQWPLVLLVDDAHWADQETLRWLAAFAERLEDLS
VLVVVARRPGEVSGDGARLLDAVAAAGRPVHNLSALTPDATAGLTRATVGRHADDAFCRE
VWAVTGGNPYDTVELLAKVRDSELPPVEAQAGELRALNRAARDGGLVDRLKGLGLEATRF
AWAAAILGTGITVDMVAQLATMNDELARTCAELLCDARILTAPEPPAGTHRTDGELEFVH
PLIATAVYNSIPAGVCTAMHGVAAQMITERGRGAAEAARHLLKVHPDDDEELVEQLREAA
REHLAVGAPDAARRCLERALAEPPLPEVHAHVLYELGCATLLTNPAVTIDHLQSALAMPG
LDDDRVDAVVRLSQALLHNDQLEEAVRTVEAEAARHEAGPVRMRLQAFQFMWEGIHGETV
SPARSRRLAELASTCAGRDNAERVLLVLRAFDAMTHGESADEVIALCDRALVNGRLAPGL
GWTDTEWGMELLMMLGSAYTYADRLDRAESLFAEARRVYTTAGWHGGHLSLANAFLGLAY
RRQGRLRDAESTLREALVLAERVGRRLPLYWSAVCGLVDTLLARGRVKDAWSVAERYGFA
PPYPSTIVLPDIRSVRGRLLLAVGRTEDGIDELEDAEKTAASRGGHNPVLAPWSVDLAKA
LAAQDPDRAAQLAADARRQAERFGTDTAIGESLRCAAALATGQRAVRLAARAVAHLEASP
CQYEHAAARVEYGIAARSAAELGRGLDLARSCGAEHLVARAREALETGRGLR
Download sequence
Identical sequences WP_015493394.1.57224 gi|474985893|ref|YP_007696359.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]