SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474986243|ref|YP_007696709.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474986243|ref|YP_007696709.1|
Domain Number 1 Region: 14-177
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.0000000000000457
Family Prokaryotic proteases 0.075
Further Details:      
 
Domain Number 2 Region: 274-474
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000149
Family Nitrogenase iron protein-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|474986243|ref|YP_007696709.1|
Sequence length 1427
Comment hypothetical protein SHJGH_7713 [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MDKQRLADIRCGYADEDKFRKLGSGYVIAPRLVLTARHVVASAWSRIVVHVGHGRLASRV
KRSATVAWVHPERDAAVLLLDEPVPVSGQVRWGQPVGTKPLPYEGIGFPEANVKDDGRRE
PEHLRGTLPLLTGGHGPGKNYALDQDVAPAGPADFEKAWGGVSGSAVFCHDHLVGVAIHD
DDAFANRRLHACPVDTFVTHPRFVELMERYAERPVLRIVTADGQSNAQAEYALDLLLRLS
EGAVSDADVVAKGPDEQLLKLSGGMYVSRQVEADILRRLDEGKVTLVVGEAGHGKTTLLW
GLHHQLNAQGRQPVLVRASDLLAGLRREGQSTAGISPPQLHAALPELAQSQKRPVLLLDT
LDLLLHSDDTRTVVVELLTSLVRLRIPTVVTCRPVEATLLRTTGVEDQLPNRRVNLLSYG
DEECRAAVHAYSRHFYAGVRTFTADEVANNVLNAASRGRALREVCANPFALRLLFEVYAP
DMPDEDVDTPRLYDEYWHKRIRSDQRAWRRPEGDQGVDLSRFAESTARLLLALGRLDITR
PELEARLRDMGTPGPVEASAAIDLLRTRGVFTLRQQVNRLWFFHQTFFEHAAARGVLSCG
AEAVQELLERVKQDPGDLFFGEVASEVLLMADRWSASGSDPLAGLLGPWLASDRPALVSL
ALPVYAKLKHPDAELVALGRATLKRAEPNDVRRFLTLLPSVVHPDSARPFGDLAVIWNRP
DSEQLALRRPLLEALIRLAATNATEAWRFIQDHACLDWLRERPVDNRGYNEYPYTAVLSA
VAAADPETVLDEALGFAERLAEAGNGGGLTDLTLGIISWCRTPRLARRAAKGVLTALERL
SPKMTSLDLERAYARLFLVSRPKLTDAASDVAEAFEAEHRGASPLSRRAVLRGWAAAVMQ
ANEAHVSDFLSACLSTRKPHQQVAVCNAVLTEALIGQPERFTRTLLAAPVWGSNDNVAVP
PLTAQVIIRCREALETLPCPHKDPDGAKTLPWLMRRALQDASLPDRMLRDLLPVVPEEVA
ERYWLTSDACCVFLVDAAAGGHPQAQHMLHKFLTDPDVRQRVTSMPNGKDSVTRIGGDLQ
RKVTSHPQFIDDLLPYADSTNQPDLVQQAVTKVLKADRSAAQAWFTSDQWSRLVDYRKRL
VKDAQPHIRRQGYMLWSALLDIGVDVHPQVTEITDALKAAAAQDVREALLGLTEDTVRAR
RWGPDSVPLVHQALQPVIDDGARRRAAGTTKRKTIAQEATARRVMAQTYANLGDLDDAYD
VADALLSLATDSGYDVADEAHRGFLSRIMEPYGFLIDRMTDHNASWAAELLVMAAEALQE
IQRVGAKWKREIARTWTGTVLRLTEGLQDAERQALARKLMTEPTLATSVLAETVDKAETT
PAWVRNLLDDPAVPGEVRTRLHGTLLLHSRQGHAHSGWPELLRFRVG
Download sequence
Identical sequences H2JWA5
gi|474986243|ref|YP_007696709.1| WP_014676500.1.21199 WP_014676500.1.57224 gi|386844032|ref|YP_006249090.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]