SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474986414|ref|YP_007696880.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474986414|ref|YP_007696880.1|
Domain Number 1 Region: 186-372
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.43e-31
Family Prokaryotic proteases 0.0000159
Further Details:      
 
Weak hits

Sequence:  gi|474986414|ref|YP_007696880.1|
Domain Number - Region: 101-151
Classification Level Classification E-value
Superfamily Alpha-lytic protease prodomain 0.068
Family Alpha-lytic protease prodomain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|474986414|ref|YP_007696880.1|
Sequence length 468
Comment hypothetical protein SHJGH_7884 [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MPKRKAAIAVGGVAALGAAALLLPNANASQDQDHAAAGGTAGARTLKAADASGLAGRLQK
ILGDAFAGSYYDSGKQQLVVNVVSGDSNVIVQAKKAGAVVRQVDNSMAELKATARTLKTR
ATIPGTSWAVDPRTDKVLVTADSTVTGANWNRLRSTVRGLGSGMATLKKSSGTFKTFVSG
GDAIFSQVQGGSVRCSLGFNVTASDGSPAFLTAGHCGVAAKKWSDSETGQPIATVDQATF
PGAGDFSLVKYDDPNTQAPSEVNAGNGQSVQINQAADATVGETVFRMGSTTGLHDGQVTG
LDATVNFQSETDPNGVDTVTGLIQTDVCAEPGDSGGSLFTQDGSALGLTSGGSGDCTSGG
ETFFQPVTTALQATGATLGGGGGGGGDNGAGDQAGAGDQAGAGDEAGAGAGDQAGAGDQS
GAGDQAGAGDQAGAGHQAGAGGDRIGGGADPSGTGAADDGSSSLTDSR
Download sequence
Identical sequences H2K0V9
gi|474986414|ref|YP_007696880.1| gi|386844203|ref|YP_006249261.1| WP_014676670.1.21199 WP_014676670.1.57224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]