SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474986862|ref|YP_007697328.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474986862|ref|YP_007697328.1|
Domain Number 1 Region: 1064-1128
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 2.41e-16
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0061
Further Details:      
 
Domain Number 2 Region: 5-194
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000193
Family RNA helicase 0.07
Further Details:      
 
Domain Number 3 Region: 743-862
Classification Level Classification E-value
Superfamily TPR-like 0.0000746
Family CT2138-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|474986862|ref|YP_007697328.1|
Sequence length 1136
Comment putative transcriptional activator [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MMAALSDRLRGGGACVVTAEPGGGRSALLAHVARAFTAGPVVTVRARAGESREPLTGIRS
LCHAVGTTLVGAADPVRELVGALRSTAAHRTVLLCVDDAHLWDAASRSALGRLAAHLPDG
SRVALLLTVAGHRPLDPEFTGLPLLRLAPLSPPDAAALLDDIAQDGLDPGVRDEITAAAE
GNPALLLRVLHRLTPAQLRGLAPLPRPVIDAETLTALVGGHLTGALPGQRDLLLVTAAAS
QVTGEATVDADLARRATAWISAGASRLGPPPRPLADKNRSAPNSGPPSWRSDGSEGRCGP
LRGPHAADSGRPESYRDPAPYDSGDSGDSRLSPYVAPLPELLHARDGRIGFRSTLLCRTV
YADASAERRRAAHDALARALPDGRGLTALLHRSWAVTGPAPSLASDLAAATAQADPAVSP
ALRCTALTRAADLTADGARQVRWYTAAAEQALLAGQSDRALRLLDTARDRPAPSTVRARA
ELLRGTVLRWDGPVDDARETLLLAAELFAPYDPERSAEAALAAADAAWSAGDLAACLSAL
AVEGTARVCSGSGTHSGGDANGPTGGAQSPGGRGLLPLAGPRFEGEPVGTVVPSPALRDH
RAGMRAVLQGRFDLAAAPLRRVVDRAWTTTERERLAHTAGAHDGGLVPAAGDHDGGLACT
ADHHHDQFAHTADDHREEPHTTDDGPAQAHTASASASGGGAAAPAGTEPLSPSTADHPRQ
AHISRSPDQFPRTTGTLRQPPPPPNAPDTLLRAASAALLLGDTTAARRAGARALAVARAD
GSAVHEARALEFLAYGELRAGRHASARAHAEEGLRSAYRTGQRNTAAHHHAVLALAASIE
GEAHTVAEHVTAALATARRQGLAQAAALAQWAAARADLGHGRPRESAERLGPLVRPGTGR
GHFAVWMLAVPCYVEACALAGQPDEAREAVEDFARWAACDADRQAPAQLLRCRALLAPPE
PADALYREALRRHGEAAGDFERARTELLYGKWLRRRRRLREARGHLRAALLGFERCGARP
WAQQAAAELRANGVAGTARTAGAAAMAGAGAAVRGGGVSASGELLPDGLDRLTPQQLRIA
RRVAQGLTNREVALSLSVSTRTVDYHLRNVFAALGVRSRVELARLVEQAEKTGAHL
Download sequence
Identical sequences H2K9W4
gi|474986862|ref|YP_007697328.1| gi|386844652|ref|YP_006249710.1| WP_014677118.1.21199 WP_014677118.1.57224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]