SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474986937|ref|YP_007697403.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474986937|ref|YP_007697403.1|
Domain Number 1 Region: 200-350
Classification Level Classification E-value
Superfamily TPR-like 6.9e-23
Family BTAD-like 0.0024
Further Details:      
 
Domain Number 2 Region: 10-78
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.00000000000177
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0066
Further Details:      
 
Domain Number 3 Region: 106-194
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.00000000000221
Family PhoB-like 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|474986937|ref|YP_007697403.1|
Sequence length 360
Comment transcriptional regulator [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MAMPTTTAGRCDRGVTGLTAEEREVLYALGCGLGNAEIAATLVLPEQVVAERLGRVLEKL
GLRDRAAAIVHAFDCGLVVPGQGPRRPEPGNSAARRTGTASGPWLSVSVLGPLRTTLAGR
PVDVGPVRQQAVLAALALSPRRSVSRRRLLEDVWGREMPDGNVVPVYVYRLRKSLRLGER
PDSVIRRDRYGYGLVQGIAEVDALCVDDLVTRAEEAERTGDLPGAVRLCAQALELFRGEP
LAGLPGPFAEAERVRLAQRRVGLAQRKADWQLRLGRRLEAITALSALALEEPLNEPVAAM
LMHALRRDGRRAEALAVFDRIARRLGDDLGVAPGDLLVRARRAALLGEDAGPGRGRAGAA
Download sequence
Identical sequences H2JL25
WP_014677193.1.21199 WP_014677193.1.57224 gi|386844727|ref|YP_006249785.1| gi|474986937|ref|YP_007697403.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]