SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474987005|ref|YP_007697471.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|474987005|ref|YP_007697471.1|
Domain Number - Region: 523-666
Classification Level Classification E-value
Superfamily TPR-like 0.0024
Family Tetratricopeptide repeat (TPR) 0.025
Further Details:      
 
Domain Number - Region: 4-74
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 0.0911
Family Reductases 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|474987005|ref|YP_007697471.1|
Sequence length 721
Comment putative ATP/GTP binding protein [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MSDLGRSRLFAGQQNRELAAEAEEMSRAFADSSHLRWITGESDPERAWEGYFAYTQPQVR
AVLDELLATFPPEDRAEALQLAGAVEAFCLPSKAVESRVFESPGVGAGHLIGVSPLVIQL
TAEIAWGLHTAHPYAPETLPAGWQTAMMRAQESFALGVFQFVRALERPSETPLPVTGLSS
AVERIGPAESFAWADPRSFQDAAMIFALAHELTHVREGHLSSGEGQSGGRLLIDRRVAPL
LGISDQENEELTADAMTFSMCFNCLLSTWAHAEESRGGADEAGTRRLSRREWDFLAWQSA
IRATEVCEAYYSAVILLEHLAWRGGDEDTALRLGTTAMRLPVVQQALQNVRQRVLVPAYG
PFMWTERDAAYRKAHHSWRLHLVEYLLPQVSRHRPSHRGHLANRYLTLPETWRDPASAAA
SLPMLEEQLATMQRELGHSHHDTLAARGNAVMGRFAADGDAHAAEVSLRLLIADMTRALG
PRHLSTFAARHNLAQVRRKAGDRVGATAAFVTLFLEELRVLGPDHTEVLDTRYELAHLRG
EEGDVEGAVAAFTSLLADRERLLGHDHVQTALTRRSLAQWRGETANPTPEVAAHHGEPLI
AHAPELSPDHANTLPAYEARLTYLERSLGHGHPDTLVTRWFLATLRAKAGDAAGAAAAYA
GLLEHDLHAVDFDDIDIGVIRANLEYWQSLVPRRDSRAWALAHAEGPARAEPSGCSSGDM
I
Download sequence
Identical sequences H2JMM4
WP_014677262.1.21199 WP_014677262.1.57224 gi|474987005|ref|YP_007697471.1| gi|386844796|ref|YP_006249854.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]