SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474987301|ref|YP_007688963.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|474987301|ref|YP_007688963.1|
Domain Number - Region: 82-131
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.003
Family GalR/LacI-like bacterial regulator 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|474987301|ref|YP_007688963.1|
Sequence length 281
Comment TPR repeat-containing protein [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MDVAENVAAGLLLAVLLGLARWVSAWWRWRRNTPRISPDPLESLMGKPLPKPDPVALRGG
ARQQLNDLLHELHSRANYPSPFAIARVLGVSRTTLHDAMSKPKLPSKDIAVRLALAYGSQ
IRWGPKADPDDELDRIDRRVSELWETAYRERALPDPEHVRRVVQEVWDDLASGCGPYPPD
DPVTEALARSTISVSTSGHFVFVIVDTRDRDDRITLGCAAEGSFCFFPWKADLAAETRFR
LAPVRISVFEVNLSEDVGLVIADGFLHPVTGTDPASPPDLA
Download sequence
Identical sequences H2KAD5
gi|386835983|ref|YP_006250151.1|NC_017766 gi|474987301|ref|YP_007688963.1|NC_020894 gi|386835983|ref|YP_006250151.1| WP_014677539.1.21199 WP_014677539.1.57224 gi|474987301|ref|YP_007688963.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]