SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474978842|ref|YP_007689308.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474978842|ref|YP_007689308.1|
Domain Number 1 Region: 871-933
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.000000000000578
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0066
Further Details:      
 
Domain Number 2 Region: 34-106,146-206
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000288
Family Extended AAA-ATPase domain 0.039
Further Details:      
 
Weak hits

Sequence:  gi|474978842|ref|YP_007689308.1|
Domain Number - Region: 575-651
Classification Level Classification E-value
Superfamily TPR-like 0.000806
Family Tetratricopeptide repeat (TPR) 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|474978842|ref|YP_007689308.1|
Sequence length 940
Comment transcriptional regulator [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MNAQTRLSPLTAVEEAQPALSLVAPRRGALPDDPGLVGRDRELRALEEFLREARAHGAAR
VLCGHPGAGKSALLEAAVQAAAATGMRVLRCTGIRGGYPPDLSGLLQIVWPVLTGPHRPD
AAGPLDALERVLVDGAPAPGGPSWLPFAVLRVLESVSRAGQPLLVAVDDWDALDPPSRDV
LAFVARRAEGHPLALLMTCRPHRTRPASLAGLPGLPLGPLDPAASARLLAARRPGLEAHA
VRELLATAAGNPLALLELPAGSEDSPPCMPASSDRLASALAPGAAHLPSGTRDLLLVAAL
HPAGDLPLLLSAASRIGGAELDFTALDPAERAGLVAFDGMRLRFGHPATAGAVVHGTDPR
RCCAAHAALAAVLAPGSVQMLWHRSQAVQECDPELADRLEAVHAQALEQCEPLMAVRLLR
RASDLHPLPADRGRCALRAAQLAHALALERMTRTMAHRALRQPLGPLGRLCAEALTGTGN
GGQPPADPAAWPAPAGAAEQENALELARITAPAVAGDDARAEALLAFLDAMPDLSDEPRL
LHAMATAGPVRRAATVLAGVSAVRHLADVPVRDLERLGAAALLAGDPLRALDLYRQAERR
HRFHDRSDQLPRVLLRQGLAHLAMGDRGQSGHAFRRCAERAEAYGQDHHAAAARLLEDLV
RGLRTGGTVRPGSAADLEAARRSVRSIDAVLAVGTACALVEAGEYGAAWPALSSLLADPR
SHAAALFALIPFAEAAEAENASEEALATLDRIEADLGAECPPVVAVRLAVARAVLADDRD
DQGDRGDQDAQALSERAFAEDLSRWPSLEAPLRLAQGRRLRRRRQFADSRTALRQAAAGY
TMLGAEARLARIAGELRAAGERADGGAPGLSRPAAARDLLTPQELRIAELAGRGLSNREV
GEQLGLAPRTIGAYLYRIFPRLGVTARAQLTEALRDPQAA
Download sequence
Identical sequences H2JLC5
WP_014669100.1.21199 WP_014669100.1.57224 gi|474978842|ref|YP_007689308.1| gi|386836567|ref|YP_006241625.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]