SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474979417|ref|YP_007689883.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474979417|ref|YP_007689883.1|
Domain Number 1 Region: 24-151
Classification Level Classification E-value
Superfamily Ricin B-like lectins 5.27e-42
Family Ricin B-like 0.00000842
Further Details:      
 
Domain Number 2 Region: 183-452
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 2.36e-28
Family Levansucrase 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|474979417|ref|YP_007689883.1|
Sequence length 463
Comment arabinofuranosidase [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MVLAAVVSVLAALAAVLVAAPAQAASSGVLRGTGSGRCLDVPNGSQTDGTYLQIYDCWDG
TNQQWTLTDSNQLTVYGNKCLDVPGHATAAGTRVQIWSCSGGANQQWRVNSDGTVVGVES
GLCLDVTGSGTANGTAVELWTCNGGSNQKWTGLSGTSTPPDGTCSLPSTYRWTSTGALAQ
PANGWVSLKDFTTVTYNGKHLVYASNVSGSSYGSMAFAPFTNWSDMASARQTGMSQAAVA
PTLFYFAPKNIWVLAYQWGASPFVYRTSSDPTNPNGWSSPQPLFTGSISGSGTGPIDQTL
IADGQNMYLFFAGDNGKIYRASMPIGNFPGNFGSSYTTVMSDTTNNLFEAVQVYKVQGQN
QYLMIVEAMGANGRYFRSFTASSLSGSWTPQAASESNPFAGKANSGAGWTNDISHGDLVR
NNPDQTMTIDPCNLQFLYQGKSPSASGPYDQLPWRPGVLTLQR
Download sequence
Identical sequences H2JWI8
gi|386837142|ref|YP_006242200.1| gi|474979417|ref|YP_007689883.1| WP_014669673.1.28171 WP_014669673.1.88765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]