SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474979439|ref|YP_007689905.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474979439|ref|YP_007689905.1|
Domain Number 1 Region: 41-393
Classification Level Classification E-value
Superfamily (Trans)glycosidases 6.74e-82
Family Putative alpha-L-fucosidase, catalytic domain 0.00000262
Further Details:      
 
Domain Number 2 Region: 524-658
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.01e-27
Family Ricin B-like 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|474979439|ref|YP_007689905.1|
Sequence length 660
Comment Alpha-L-fucosidase [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MSSSSLPVSRRRLLAAAGAATAFGLLRFAPEAAATDGPGSYTASWPSVDQHPPAPAWFQD
AKFGIYYHWGVFSVPAFGNEWYPRNMYIGGSNENRHHIATYGDPSVWPYHNFIDGARDKA
GNYVQFAPQLASKGGDFDPDAWARLFKSAGARFAGPVAEHHDGFSMWNSRANPWNSVQHG
PRLDLVGLHAQAIRGQGLKFMASLHHAYHFNGYYDHVPSQSDATLRVLYGQQGTAAENKL
WFDKLVEVIDGYQPDLIWQDFDLGLVQESYRLQFLAHYYNRAVSWNKDVVATYKDGLNAK
GEVYDFERGGPAGLLTPYWLTDDSISSSSWCYTTGIGYYSTQALLHSLIDRVSKGGNMLL
NIAPTAAGVIPSGQQSILLGMGDWLGRFGEAVYSTRSWTSYGEGPTKMGGGSFSGPVAGT
AKDIRFTRSQDDKTLYATALGWQGGTMTITTLNSNQFSLGTLTSAQLLNNTAGSYTDLPA
PVQDASGLHLTMPSANPPFSALAYTVKLTFSGRIPPLGGPGGSTTWVKIANVTSGLVLDS
GGNVASGSNLKQWNYDGSANLQWQLIDLGNGYHRIMNRANGMAADSWGDSANGAPARQAA
WNGGDNQQWSLNSLGGNRYQIVNRGTGTALDGSGSTTVGSTTVMWTPNSSSNNEWTITGT
Download sequence
Identical sequences H2JXZ1
gi|386837163|ref|YP_006242221.1| gi|474979439|ref|YP_007689905.1| WP_014669694.1.21199 WP_014669694.1.57224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]