SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474979440|ref|YP_007689906.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474979440|ref|YP_007689906.1|
Domain Number 1 Region: 305-434
Classification Level Classification E-value
Superfamily Ricin B-like lectins 2.1e-39
Family Ricin B-like 0.0000347
Further Details:      
 
Domain Number 2 Region: 34-275
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 6.39e-21
Family Carboxylesterase/thioesterase 1 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|474979440|ref|YP_007689906.1|
Sequence length 436
Comment hypothetical protein SHJGH_0906 [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MSIAAAILLVLSAAGISFGSARAVTAAPATTGTVRATAGCGKAPALTSGTHTIQSGGQTR
SYLLRVPAGYDNNHPYRLIFGFHWRGGTANDVDSGGTDGYNWSYYGLRRLADANNSTIFV
APQGNGNGWANPGGQDVAFVDAMVSQIEAGLCVDTTQLFSAGFSYGGAMSYALACSRATV
FRAVAVYSGANLSGCEGGTQPIAYMGLHGIRDDVLPIASGRQLRDTFVRNNGCTPQNPPE
PAYGSLTHFITAYSGCRSGYPVVWAAFDGAGHDPGPIDGSTGDGWRTWTSAAVWQFFTQF
DSNPPPSTGNQEIVGQQSGRCLDINNSTTANGTQAQLWDCNGGSNQRWTYTSGKQLVVYG
NKCLSAGQTAANGTPAAIWDCNGQPDQQWNINSDGTITALRSGLCLDASGQGTANATKIQ
LWTCTGGTNQRWRLQN
Download sequence
Identical sequences A0A101PVA6
gi|474979440|ref|YP_007689906.1| WP_015493140.1.21199 WP_015493140.1.28171 WP_015493140.1.57224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]