SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474982911|ref|YP_007693377.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474982911|ref|YP_007693377.1|
Domain Number 1 Region: 247-537
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00000000000942
Family Quinoprotein alcohol dehydrogenase-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|474982911|ref|YP_007693377.1|
Sequence length 611
Comment hypothetical protein SHJGH_4378 [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MTQPPNQPPQGGFGPPQDQSPGDRPPQDRPPQAGGFGPAPQTPPAQGGFGPAPQTPPAQG
GFGPAPQTPPPPPPGYGYPQQPQQPGPYGSAPGPYGYPQQPPQQPGPYGAPQPGYGHPQQ
PPYPAMPGAAPGGPLDGRPGGRKKTALIVGSAVAALLVIGGTVFAVTGGDSGGGEKKKPV
ARQSDDPKNSATASPATSGGGEDPENLNKGRRPGEAKVLWYKPAPDAPASGADAPGMWIT
GDTAVKAAYKQVFAFRTGDGGTAWGPLDLPQKICAVTPQKSADDKIVVAYLNGAGDRAKC
NQLQQLDLRTGEKGWSAEVADGGLFDSALTVELTLSGKTLMVGRSQSGTAYDIDSGKKLY
DKKKYGAACFPAAFAGGTGRLVQVASCGAGTAKEHEEIQELDPATGKVRWTQPVKKGWEV
TRTYSVDPLVVYLTNRDKKAWNISTFTKNGTFRSEVKVNEKFAPRCGWAVLERELQGCQG
VAVDAGMLYLPTDSTVSANEIVAISLSDGKEKWRVKSPVDQPMAPVKVEGGKLIAYVQPS
YDAGGQVVSVPVAGSSHRTTRLLQNPQGAAQVEDTFYDGVVDWAGGRFFISSGRLSGDDD
SKEKLMMAFGN
Download sequence
Identical sequences H2JSX7
gi|474982911|ref|YP_007693377.1| gi|386840702|ref|YP_006245760.1| WP_014673213.1.21199 WP_014673213.1.57224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]