SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474982971|ref|YP_007693437.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474982971|ref|YP_007693437.1|
Domain Number 1 Region: 8-263
Classification Level Classification E-value
Superfamily LigB-like 3.66e-83
Family LigB-like 0.00000727
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|474982971|ref|YP_007693437.1|
Sequence length 263
Comment hypothetical protein SHJGH_4438 [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MSATAQERMPALYLSHGAPPLADDPVWPGQLAAWSADLPRPKAILMVSAHWEEAPLALGA
VETVPLVYDFWGFPEHYYQVRYAAPGAPALAESVRKLLRAPGIPVQDIPDRGLDHGAYVP
LVEMFPDADIPVLQISLPTLDPVRLMDIGRKLAPLRDEGVLIVGSGFFTHNLAALRYAGR
GVPSWSSEFDDWGRRALETRDWDALLDFLNKAPAGRYAHPRTEHFAPLFVTMGAAEAGGE
LDAQKSVIDGFWMGMAKRSVQFG
Download sequence
Identical sequences A0A0S2P0X0 H2JU89
gi|474982971|ref|YP_007693437.1| WP_014673273.1.21199 WP_014673273.1.57224 WP_014673273.1.88765 gi|386840762|ref|YP_006245820.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]