SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474985090|ref|YP_007695556.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474985090|ref|YP_007695556.1|
Domain Number 1 Region: 45-220
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.00000000000898
Family Prokaryotic proteases 0.027
Further Details:      
 
Domain Number 2 Region: 276-420
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000388
Family Extended AAA-ATPase domain 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|474985090|ref|YP_007695556.1|
Sequence length 1336
Comment hypothetical protein SHJGH_6559 [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MDEDCAAGGPGAGPAHRALATAPADDTGAGAGTGRCAAALVRIRDLAGRPRGLGFLADHE
GTLLTSHEAVDGLPRLVLHADGDRTCVVGPDAVTALPGLDLALVRTEGLGVEPLPLTVRE
RIDAGTYVQVAAGCWREARVLAATQVTYTATDRFHLLDDALELAIGTAGRDALRLGGGAA
GGPVLDARTGAVVGVLGTALHSAQRDAGFAVPLRPVDGALADLLARNAATVPAYGADLNL
AGILQLTMTSVGQDGPPGAVEPVERAGIAGELAAFATGDRPVLGLVGAPGSGRTTELAAL
AARRARGERPAPTLWLRGAGLRGTDASVADVARRALTRAARIIAASRSGRPEDLGDITPE
RVARLAARAGRPLLLLLDCPEEMPPALADRLSAWAQGTATWLTETGTRLVVACREEHWER
TGRAFPPAALHVPGDPGEPVRTPPDDRVPAGGGEPSATEPGAGAPTSDPGPDRAPADSAA
RADGAGAVHASAGSAVEAGGAGAVYAAAGSAAPAGGGEPLHSAPAGPASSPDDAEPRVPL
PRLALPAGSPDPHHPPARLASPADSPVPDPTPGTPATPAQASPAPAESVPGVLGVPGVPD
VPGEAPLTPATDPLPPCLRVGDFTVGEARWARVRYGIPEGALGERDARHPLVLRLLSEVR
AAVPDAPVVGPLDRHDVFAAYLDLMCLRIAVRLAAAGGLRGTAARRLAARVAGQVHEAAR
RSLGPGQGELDGESFEAVFPWGPAPARLGGGTGWASAVLTEGLLVPAGTGYRFAHEELAD
WIQGMHLDLDAALLALVHRVGEPSAPRPVPHHRVGPVVQALLLLARQQGTGQLALRLREL
VDALDRDTGSWWAARLLARTLLQVPDATPYTEVLRLLADRVVAWHGARRPVPADFRPAFW
TGLPVPDAERLDLLRRLVLADPAPPAAGDRYLDAVAGLLTAAPTAVQPLLTRWFTDERPL
PATPHATVATAAQALLHTHRHGALDDLTEVLVVCSHRRADELLAVLAEEEPSALCRAVDR
WAHDERPARRVAAVAFALRAAPHARSDADRELLRYAALTLLARPADRTLHGAALALLVRD
PRSRDRHLPAALRHFTDGDPQFPPSALVPALTTHPEPVLEAFRVRLCAPGAGGPETGAVL
RGLIQVGTPALARRVAALVQEALRLRPETAGPVAGQVAGHVGRRLEQGPTARPVLLPLVT
GLLDGAPEPLRAALATVLAAPGTPASRPFRRELLEFLLAREEEPSVLLAVLHAATEHGGR
EEEARGLVHRTGLLLVRTPEGATRFDRALVDIGRHVPGFAARMARWLNETPDDWAAVVGP
SARRMIESLAGVRVPA
Download sequence
Identical sequences gi|474985090|ref|YP_007695556.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]