SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474985902|ref|YP_007696368.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|474985902|ref|YP_007696368.1|
Domain Number - Region: 126-193
Classification Level Classification E-value
Superfamily Prim-pol domain 0.000111
Family PriA-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|474985902|ref|YP_007696368.1|
Sequence length 335
Comment hypothetical protein SHJGH_7372 [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MELEVAGRTVRLSSPDKVFFPERGFTKLDLARYYAAVGPGILRALRNRPTTLERYPDGVG
GEWFYQKRAPKGMPGWIPTAHITFPSGRSADEMCPTEEAAVVWAAQYGTLTFHPWPVRAT
DVDHPDELRIDLDPQPGTDYADAARAARELRAVLDEFGGLRGWPKTSGGRGLHVFVPIEP
RWTFTQVRRAAIAVGREMERRMPDRVTIKWWKEERGSRIFLDYNQTARDRTIASAYSVRP
RPHAPVSAPLRWEEVGVAEPRDFDLATMPARFTDLGDVHADMDDHAFSLDTLLELARQDE
HDHGLGDLPYPPEYPKMPGEPKRVQPSRARREPSP
Download sequence
Identical sequences H2JQM4
gi|386843693|ref|YP_006248751.1| gi|474985902|ref|YP_007696368.1| WP_014676163.1.21199 WP_014676163.1.57224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]