SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|474986357|ref|YP_007696823.1| from Streptomyces hygroscopicus subsp. jinggangensis TL01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474986357|ref|YP_007696823.1|
Domain Number 1 Region: 34-280
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.05e-70
Family Glycosyl hydrolases family 16 0.0036
Further Details:      
 
Domain Number 2 Region: 282-409
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.07e-42
Family Ricin B-like 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|474986357|ref|YP_007696823.1|
Sequence length 410
Comment secreted hydrolase [Streptomyces hygroscopicus subsp. jinggangensis TL01]
Sequence
MASPRLLRRCLLAALSAALIGSAAVGPARADAAAPTAAAVTTFSDTFDGPAGAAVDSSKW
TLETGDNVNNHERQYYTSGTKNAALDGQGHLVITARKENPAGYQCWYGSCQYTSARLNTA
GKFNAQYGHVEARMKIPRGQGMWPAFWMLGTPVNWPDSGEIDVMENVGFEPSTVHGTIHG
PGYSGSGGIGAGYSLPNGQAFADAFHTFAVDWAPDSITWSVDGNVYQRRTPADLGGKTWV
FNKPFFLILNLAVGGYWPGDPDGSTQFPQTLLVDSVSVTTSDSAAGVPIRGLAGKCVDVA
GANPANGTPVQLYDCNGSAAQAWTVGSDGTLRALGKCLDVSGGGTADGTPVQLYDCNGSA
AQKWALPAARDIVNPQANKCLDVTGNNSANGTRLQIWTCTGAANQKWTVG
Download sequence
Identical sequences H2JZC6
gi|386844146|ref|YP_006249204.1| gi|474986357|ref|YP_007696823.1| WP_014676613.1.21199 WP_014676613.1.57224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]