SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37524260|ref|NP_927604.1| from Photorhabdus luminescens subsp. laumondii TTO1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37524260|ref|NP_927604.1|
Domain Number 1 Region: 3-193
Classification Level Classification E-value
Superfamily HAD-like 1.95e-41
Family YihX-like 0.000000838
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37524260|ref|NP_927604.1|
Sequence length 208
Comment phosphatase [Photorhabdus luminescens subsp. laumondii TTO1]
Sequence
MLYIFDMGNVIIEIDFKRVLAVWSNLSGTPLATLTKSFSMGETFEKHERGQITDLEFADT
LCQEMNISLSFEQFAAGWHAIFINIRPEVIQIMKTLREAGHRVVVLSNTNRLHLDYWPHN
YPEIAASADYLYLSQDLAMRKPEPDIFKYVLETEGYSPDQAVFFDDVLENVEAAKALGIN
SVHVVDRQTVPDYFEAIGFSEQNEGLNG
Download sequence
Identical sequences Q7N9S3
WP_011144640.1.100813 WP_011144640.1.49830 243265.plu0241 gi|37524260|ref|NP_927604.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]