SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37524355|ref|NP_927699.1| from Photorhabdus luminescens subsp. laumondii TTO1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37524355|ref|NP_927699.1|
Domain Number 1 Region: 1-155
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.83e-36
Family SMI1/KNR4-like 0.0000154
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37524355|ref|NP_927699.1|
Sequence length 156
Comment hypothetical protein plu0342 [Photorhabdus luminescens subsp. laumondii TTO1]
Sequence
MNYIDLIEKEMISSGEEILSSGGVDIDTIREFESLLGVTFPESYKFFLQKYGTLSFGGDD
YYGITKKGINGNQAPCILYVTKQARDSGDIDEGMIKIKSSGYGPSYSIDTNIKGKTGEAV
VVETELSFKRDGAKNIIADSYAEFLLEEIKQAIEDL
Download sequence
Identical sequences Q7N9I9
243265.plu0342 WP_011144735.1.100813 WP_011144735.1.49830 gi|37524355|ref|NP_927699.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]