SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37525997|ref|NP_929341.1| from Photorhabdus luminescens subsp. laumondii TTO1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37525997|ref|NP_929341.1|
Domain Number 1 Region: 14-302
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 6.23e-26
Family Thioesterases 0.00000000379
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37525997|ref|NP_929341.1|
Sequence length 307
Comment acyl transferase [Photorhabdus luminescens subsp. laumondii TTO1]
Sequence
MENKSKYKTIDHVLCVEGNKKIHVWETLPEENSPKRKNTIIIASGFARRMDHFAGLAEYL
SRNGFHVIRYDSLHHVGLSSGTIDEFTMSIGKQSLLAVVDWLNTRKINNRGILASSLSAR
IVYASLSEINVSFLITAVGVVNLRYTLERALGFDYLSLPINELPNNLDFEGHKLGAEVFA
RDCLDFGWEDLTSTINSMMYLDIPFIAFTANNDNWVKQDEVITLLSNIRSNRCKIYSLLG
SSHDLGENLVVLRNFYQSVTKAAIAMDNDRLDIDVDIIEPSFEHLTIATVNERRMKIEIE
NQAISLS
Download sequence
Identical sequences Q7N576
243265.plu2080 WP_011146335.1.100813 WP_011146335.1.49830 gi|37525997|ref|NP_929341.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]