SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37527927|ref|NP_931272.1| from Photorhabdus luminescens subsp. laumondii TTO1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37527927|ref|NP_931272.1|
Domain Number 1 Region: 25-245
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.0000000000159
Family Thioesterases 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37527927|ref|NP_931272.1|
Sequence length 247
Comment hypothetical protein plu4080 [Photorhabdus luminescens subsp. laumondii TTO1]
Sequence
MIQHNNHAGCFSLEAVILAPVMPFWDHGDFCTPLRILLQKMGYQVSIIDTLSLINSSDPD
YAINIIESELNQRFFQPYLLIGFAMSGTLAQLLASRLKNLTGVISVSGPGYADSLLTNKL
EQLIALLNRNQLDEAISVLHDFVIPEGGTPLPKMPAIPGHLRNTARERMIVGFSLLLQLD
ARAILCNYKGKFLSIVGGRSQLATECNQVVNTNPTHCFVVVDGAGMRPWEDKPLFINNVI
NDWLKIL
Download sequence
Identical sequences Q7N023
gi|37527927|ref|NP_931272.1| 243265.plu4080 WP_011148203.1.100813 WP_011148203.1.49830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]