SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37528709|ref|NP_932054.1| from Photorhabdus luminescens subsp. laumondii TTO1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37528709|ref|NP_932054.1|
Domain Number 1 Region: 273-447,742-845
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.68e-22
Family ABC transporter ATPase domain-like 0.04
Further Details:      
 
Domain Number 2 Region: 42-152
Classification Level Classification E-value
Superfamily PHP domain-like 0.00000000922
Family PHP domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37528709|ref|NP_932054.1|
Sequence length 887
Comment hypothetical protein plu4903 [Photorhabdus luminescens subsp. laumondii TTO1]
Sequence
MTIQTNKYAKARFFKCALQVNASGYIKYRGQQQALSEDDYNQQLLNAALEMRIEVIGLAD
HGSVNGFEKIRDLFTQHGIVVFPCFEVASSEKIHFVCLFDESESADQIKMHLGALDVDIN
QPEAPVQKSATDIINYVNDKGGFIFAAHCTNDDGVLKRRMNHIWQHKGLLAAQIPGSVED
LKGVESDFYRKVFLNKDDNYRRKREMAAINAADVAKPEEIKADGASCLIKMTKPCFTSFK
QAFLDAGSRVRLNSDKSENYASAIERVRFVGGYLDGMDIELSDHLNAVIGGRGTGKSTLL
ECIRYAFDLEPFGKASKAQHDAIVKNNLGLEKGMVEVRVRSATMHGRIFTVSRKYGNQPV
VVENENGRISPYHPKDLLPGVELYGQNEIYEMTRDEQSRNLLIKRFLESEHEQFDKAITE
VLESLKDNRETIIRALSQKADVEAEVERLPKLLDQAKQFQALGIDEKLKVIPTLEKEKQL
NERVNEEITRIKEAINILKDSLPDTVFLSDASLEGLPHSNLLKQKRQVLEMLKNSLTQCL
IRVEELSSKASGDLLPLQQQLSERLRAEEQQLENAFKDIPASQGKTGRQIGAEYQTLLKQ
IEQIRPKETALQNRQTQLNELYSQRKKLLLELDQQTSARASAMQNSVKRLTRKLDQKVRL
SLNSEGNRQELVNFLSDCNLEGIGQERLAWVLESEFTPANLAATIRQGEAELTSNFGISN
SVVRALSRLPKRKLLELEELLLPDTMAIELNITHGEREAVFRPIGELSTGQQCTAILHLL
LLDNQDPLILDQPEDNLDNAFIAERIVAELRRAKLSRQFLFATHNANIPVFGDAEWIGVL
SVEDNKGLIRPEQQGAIDMPEVQKLAADILEGGKSAFNQRREKYGFN
Download sequence
Identical sequences Q7MXZ6
gi|37528709|ref|NP_932054.1| 243265.plu4903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]