SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1a6v_I from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1a6v_I
Domain Number 1 Region: 1-120
Classification Level Classification E-value
Superfamily Immunoglobulin 4.28e-54
Family V set domains (antibody variable domain-like) 0.0000035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 1a6v_I
Sequence length 120
Comment mol:protein length:120 B1-8 FV (HEAVY CHAIN)
Sequence
qvqlqqpgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpnsggtky
nekfkskatltvdkpsstaymqlssltsedsavyycarydyygssyfdywgqgttvtvss
Download sequence
Identical sequences 000034871|e1a6wH1|11.1.1.765|H:1-120 000034878|e1a6uH1|11.1.1.765|H:1-120 000035114|e1a6vJ1|11.1.1.765|J:1-120 cath|current|1a6uH00/301-420 cath|current|1a6vH00/301-418 cath|current|1a6vI00/301-419 cath|current|1a6vJ00/301-420 cath|current|1a6wH00/301-420 d1a6uh_ d1a6vj_ d1a6wh_ 1a6wH 1a6u_H 1a6v_H 1a6v_I 1a6v_J 1a6w_H

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]