SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1b2w_L from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1b2w_L
Domain Number 1 Region: 1-112
Classification Level Classification E-value
Superfamily Immunoglobulin 1.33e-41
Family V set domains (antibody variable domain-like) 0.0000138
Further Details:      
 
Domain Number 2 Region: 110-212
Classification Level Classification E-value
Superfamily Immunoglobulin 5.12e-28
Family C1 set domains (antibody constant domain-like) 0.00000866
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 1b2w_L
Sequence length 214
Comment mol:protein length:214 PROTEIN (ANTIBODY (LIGHT CHAIN))
Sequence
diqmtqspstlsasvgdrvtitckasenvdtyvswyqqkpgkapklliygasnrytgvps
rfsgsgsgtdftltisslqpddfatyycgqsynypftfgqgtkvevkrtvaapsvfifpp
sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
lskadyekhkvyacevthqglsspvtksfnrgec
Download sequence
Identical sequences 1t3fA 1b2w_L 1t04_A 1t04_C 1t3f_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]