SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1ba7_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ba7_A
Domain Number 1 Region: 2-175
Classification Level Classification E-value
Superfamily STI-like 2.26e-66
Family Kunitz (STI) inhibitors 0.00000071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 1ba7_A
Sequence length 181
Comment mol:protein length:181 TRYPSIN INHIBITOR (KUNITZ)
Sequence
dfvldnegnplenggtyyilsditafggiraaptgnercpltvvqsrneldkgigtiiss
pyrirfiaeghplslkfdsfavimlcvgiptewsvvedlpegpavkigenkdamdgwfrl
ervsddefnnyklvfcpqqaeddkcgdigisidhddgtrrlvvsknkplvvqfqkldkes
l
Download sequence
Identical sequences 1avu_A 1ba7_A 1ba7_B cath|current|1avuA00/1-177 cath|current|1ba7A00/1-176 cath|current|1ba7B00/1-176 1ba7A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]