SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1bx2_E from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1bx2_E
Domain Number 1 Region: 4-82
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 7.63e-61
Family MHC antigen-recognition domain 0.003
Further Details:      
 
Domain Number 2 Region: 95-186
Classification Level Classification E-value
Superfamily Immunoglobulin 2.81e-29
Family C1 set domains (antibody constant domain-like) 0.0000487
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 1bx2_E
Sequence length 191
Comment mol:protein length:191 PROTEIN (HLA-DR2)
Sequence
trprflwqpkrechffngtervrfldryfynqeesvrfdsdvgefravtelgrpdaeywn
sqkdileqaraavdtycrhnygvvesftvqrrvqpkvtvypsktqplqhhnllvcsvsgf
ypgsievrwflngqeekagmvstgliqngdwtfqtlvmletvprsgevytcqvehpsvts
pltvewrarse
Download sequence
Identical sequences 1bx2B 1bx2_B 1bx2_E

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]