SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1d3e_I from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1d3e_I
Domain Number 1 Region: 1-82
Classification Level Classification E-value
Superfamily Immunoglobulin 4.82e-27
Family I set domains 0.0000263
Further Details:      
 
Domain Number 2 Region: 82-176
Classification Level Classification E-value
Superfamily Immunoglobulin 2.27e-23
Family C2 set domains 0.0000027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 1d3e_I
Sequence length 185
Comment mol:protein length:185 PROTEIN (INTERCELLULAR ADHESION MOLECULE-1)
Sequence
qtsvspskvilprggsvlvtcstscdqpkllgietplpkkelllpgnnrkvyelsnvqed
sqpmcysncpdgqstaktfltvywtpervelaplpswqpvgknltlrcqveggapranlt
vvllrgekelkrepavgepaevtttvlvrrdhhganfscrteldlrpqglelfentsapy
qlqtf
Download sequence
Identical sequences 1d3lA 1d3e_I 1d3i_I 1d3l_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]