SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1dzq_C from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1dzq_C
Domain Number 1 Region: 5-238
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.47e-80
Family Legume lectins 0.000000868
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 1dzq_C
Sequence length 242
Comment mol:protein length:242 LECTIN II
Sequence
nlsddlsfnfdkfvpnqkniifqgdasvsttgvlqvtkvskptttsigralyaapiqiwd
sitgkvasfatsfsfvvkadksdgvdglafflapansqipsgssagmfglfsssdskssn
qiiavefdtyfgkaynpwdpdfkhigidvnsiksiktvkwdwrngevadvvityraptks
ltvclsypsdgtsniitasvdlkailpewvsvgfsggvgnaaefethdvlswyftsnlea
nn
Download sequence
Identical sequences 1qnwA cath|current|1dzqA00/3-239 cath|current|1dzqB00/3-239 cath|current|1dzqC00/3-239 cath|current|1dzqD00/3-239 cath|current|1qnwA00/3-239 cath|current|1qnwB00/3-239 cath|current|1qnwC00/3-239 cath|current|1qnwD00/3-239 cath|current|1qooA00/3-239 cath|current|1qooB00/3-239 cath|current|1qooC00/3-239 cath|current|1qooD00/3-239 cath|current|1qosA00/3-239 cath|current|1qosB00/3-239 cath|current|1qotA00/3-239 cath|current|1qotB00/3-239 cath|current|1qotC00/3-239 cath|current|1qotD00/3-239 1dzq_A 1dzq_B 1dzq_C 1dzq_D 1qnw_A 1qnw_B 1qnw_C 1qnw_D 1qoo_A 1qoo_B 1qoo_C 1qoo_D 1qos_A 1qos_B 1qot_A 1qot_B 1qot_C 1qot_D

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]