SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1fym_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1fym_A
Domain Number 1 Region: 3-89
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.16e-45
Family Heat-shock transcription factor 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 1fym_A
Sequence length 92
Comment mol:protein length:92 HEAT SHOCK TRANSCRIPTION PROTEIN
Sequence
arpafvnklwsmvndksnekfihwstsgesivvpnrerfvqevlpkyfkhsnfasfvrql
nmygwhkvqdvksgsmlsnndsrwefenerha
Download sequence
Identical sequences 000045849|e3hsfA1|101.1.2.57|A:1-92 000045857|e1fymA1|101.1.2.57|A:1-92 cath|current|1fymA00/193-284 cath|current|1fymB00/193-280 cath|current|2hsf000/1-92 cath|current|2htsA00/194-285 cath|current|3hsfA00/1-92 d1fyka_ d1fyma_ d2htsa_ d3hsfa_ 2htsA 1fyk_A 1fyl_A 1fyl_B 1fym_A 1fym_B 2hts_A 3hsf_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]