SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1g7y_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1g7y_B
Domain Number 1 Region: 2-238
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.01e-79
Family Legume lectins 0.000000901
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 1g7y_B
Sequence length 253
Comment mol:protein length:253 STEM/LEAF LECTIN DB58
Sequence
adiqsfsfknfnsssfilqgdatvsssklrltkvkgnglptlsslgrafysspiqiydks
tgavaswatsftanifapnksssadgiafalvpvgsepksnsgflgvfdsdvydnsaqtv
avefdtfsntdwdptsrhigidvnsiksirtaswglangqnaeilitynaatsllvaslv
hpsrrtsyivservditnelpeyvsigfsattglsegytethdvlswsfasklpddstte
pldiasylvrnvl
Download sequence
Identical sequences 1g7yA 1g7y_A 1g7y_B 1g7y_C 1g7y_D 1g7y_E 1g7y_F 1lul_A 1lul_B 1lul_C 1lul_D 1lul_E 1lul_F cath|current|1g7yA00/1-253 cath|current|1g7yB00/1-253 cath|current|1g7yC00/1-253 cath|current|1g7yD00/1-253 cath|current|1g7yE00/1-253 cath|current|1g7yF00/1-253 cath|current|1lulB00/1-253 cath|current|1lulC00/1-253 cath|current|1lulE00/1-253 d1g7ya_ d1g7yb_ d1g7yc_ d1g7yd_ d1g7ye_ d1g7yf_ d1lulb_ d1lulc_ d1lule_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]