SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1g9e_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1g9e_A
Domain Number 1 Region: 1-117
Classification Level Classification E-value
Superfamily Immunoglobulin 8.84e-47
Family V set domains (antibody variable domain-like) 0.0000192
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 1g9e_A
Sequence length 117
Comment mol:protein length:117 H14
Sequence
QVQLQESGGGLVQAGGSLRLSCAASGRTGSTYDMGWFRQAPGKERESVAAINWDSARTYY
ASSVRGRFTISRDNAKKTVYLQMNSLKPEDTAVYTCGAGEGGTWDSWGQGTQVTVSS
Download sequence
Identical sequences A2KD53
000035462|e1g9eA1|11.1.1.179|A:1-117 cath|current|1g9eA00/1-117 d1g9ea_ 1g9eA 1g9e_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]